
                                prettyplot 



Function

   Displays aligned sequences, with colouring and boxing

Description

   prettyplot reads in a set of aligned DNA or protein sequences. It
   displays them graphically, with conserved regions highlighted in
   various ways.

Usage

   Here is a sample session with prettyplot


% prettyplot -resbreak=10 -boxcol -consensus -plurality=3 
Displays aligned sequences, with colouring and boxing
Input sequence set: globins.msf
Graph type [x11]: cps

Created prettyplot.ps

   Go to the input files for this example
   Go to the output files for this example

   Example 2


% prettyplot globins.msf -plurality=3 -docolour 
Displays aligned sequences, with colouring and boxing
Graph type [x11]: cps

Created prettyplot.ps

   Go to the output files for this example

Command line arguments

   Standard (Mandatory) qualifiers:
  [-sequences]         seqset     File containing a sequence alignment
   -graph              graph      Graph type

   Additional (Optional) qualifiers:
   -matrixfile         matrix     This is the scoring matrix file used when
                                  comparing sequences. By default it is the
                                  file 'EBLOSUM62' (for proteins) or the file
                                  'EDNAFULL' (for nucleic sequences). These
                                  files are found in the 'data' directory of
                                  the EMBOSS installation.
   -residuesperline    integer    The number of residues to be displayed on
                                  each line
   -resbreak           integer    Residues before a space
   -[no]ccolours       boolean    Colour residues by their consensus value.
   -cidentity          string     Colour to display identical residues (RED)
   -csimilarity        string     Colour to display similar residues (GREEN)
   -cother             string     Colour to display other residues (BLACK)
   -docolour           boolean    Colour residues by table oily, amide etc.
   -[no]title          boolean    Do not display the title
   -shade              string     Set to BPLW for normal shading
                                  so for pair = 1.5,1.0,0.5 and shade = BPLW
                                  Residues score Colour
                                  1.5 or over....... BLACK (B)
                                  1.0 to 1.5 ....... BROWN (P)
                                  0.5 to 1.0 ....... WHEAT (L)
                                  under 0.5 ....... WHITE (W)
                                  The only four letters allowed are BPLW, in
                                  any order.
   -pair               string     Values to represent identical similar
                                  related
   -identity           integer    Only match those which are identical in all
                                  sequences.
   -[no]box            boolean    Display prettyboxes
   -boxcol             boolean    Colour the background in the boxes
   -boxcolval          string     Colour to be used for background. (GREY)
   -[no]name           boolean    Display the sequence names
   -maxnamelen         integer    Margin size for the sequence name.
   -[no]number         boolean    Display the residue number
   -[no]listoptions    boolean    Display the date and options used
   -plurality          float      Plurality check value (totweight/2)
   -consensus          boolean    Display the consensus
   -[no]collision      boolean    Allow collisions in calculating consensus
   -alternative        integer    Use alternative collisions routine
                                  0) Normal collision check. (default)
                                  1) checks identical scores with the max
                                  score found. So if any other residue matches
                                  the identical score then a collision has
                                  occurred.
                                  2) If another residue has a greater than or
                                  equal to matching score and these do not
                                  match then a collision has occurred.
                                  3) Checks all those not in the current
                                  consensus.If any of these give a top score
                                  for matching or identical scores then a
                                  collision has occured.
   -showscore          integer    Print residue scores
   -portrait           boolean    Set page to Portrait

   Advanced (Unprompted) qualifiers: (none)
   Associated qualifiers:

   "-sequences" associated qualifiers
   -sbegin1             integer    Start of each sequence to be used
   -send1               integer    End of each sequence to be used
   -sreverse1           boolean    Reverse (if DNA)
   -sask1               boolean    Ask for begin/end/reverse
   -snucleotide1        boolean    Sequence is nucleotide
   -sprotein1           boolean    Sequence is protein
   -slower1             boolean    Make lower case
   -supper1             boolean    Make upper case
   -sformat1            string     Input sequence format
   -sdbname1            string     Database name
   -sid1                string     Entryname
   -ufo1                string     UFO features
   -fformat1            string     Features format
   -fopenfile1          string     Features file name

   "-graph" associated qualifiers
   -gprompt             boolean    Graph prompting
   -gtitle              string     Graph title
   -gsubtitle           string     Graph subtitle
   -gxtitle             string     Graph x axis title
   -gytitle             string     Graph y axis title
   -goutfile            string     Output file for non interactive displays
   -gdirectory          string     Output directory

   General qualifiers:
   -auto                boolean    Turn off prompts
   -stdout              boolean    Write standard output
   -filter              boolean    Read standard input, write standard output
   -options             boolean    Prompt for standard and additional values
   -debug               boolean    Write debug output to program.dbg
   -verbose             boolean    Report some/full command line options
   -help                boolean    Report command line options. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning             boolean    Report warnings
   -error               boolean    Report errors
   -fatal               boolean    Report fatal errors
   -die                 boolean    Report deaths


   Standard (Mandatory) qualifiers Allowed values Default
   [-sequences]
   (Parameter 1) File containing a sequence alignment Readable set of
   sequences Required
   -graph Graph type EMBOSS has a list of known devices, including
   postscript, ps, hpgl, hp7470, hp7580, meta, colourps, cps, xwindows,
   x11, tektronics, tekt, tek4107t, tek, none, null, text, data, xterm,
   png, xml EMBOSS_GRAPHICS value, or x11
   Additional (Optional) qualifiers Allowed values Default
   -matrixfile This is the scoring matrix file used when comparing
   sequences. By default it is the file 'EBLOSUM62' (for proteins) or the
   file 'EDNAFULL' (for nucleic sequences). These files are found in the
   'data' directory of the EMBOSS installation. Comparison matrix file in
   EMBOSS data path EBLOSUM62 for protein
   EDNAFULL for DNA
   -residuesperline The number of residues to be displayed on each line
   Any integer value 50
   -resbreak Residues before a space Integer 1 or more Same as
   -residuesperline to give no breaks
   -[no]ccolours Colour residues by their consensus value. Boolean value
   Yes/No Yes
   -cidentity Colour to display identical residues (RED) Any string is
   accepted RED
   -csimilarity Colour to display similar residues (GREEN) Any string is
   accepted GREEN
   -cother Colour to display other residues (BLACK) Any string is
   accepted BLACK
   -docolour Colour residues by table oily, amide etc. Boolean value
   Yes/No No
   -[no]title Do not display the title Boolean value Yes/No Yes
   -shade Set to BPLW for normal shading so for pair = 1.5,1.0,0.5 and
   shade = BPLW Residues score Colour 1.5 or over....... BLACK (B) 1.0 to
   1.5 ....... BROWN (P) 0.5 to 1.0 ....... WHEAT (L) under 0.5 .......
   WHITE (W) The only four letters allowed are BPLW, in any order. A
   string up to 4 characters, matching regular expression
   /^([BPLW]{4})?$/ An empty string is accepted
   -pair Values to represent identical similar related Any string is
   accepted 1.5,1.0,0.5
   -identity Only match those which are identical in all sequences.
   Integer 0 or more 0
   -[no]box Display prettyboxes Boolean value Yes/No Yes
   -boxcol Colour the background in the boxes Boolean value Yes/No No
   -boxcolval Colour to be used for background. (GREY) Any string is
   accepted GREY
   -[no]name Display the sequence names Boolean value Yes/No Yes
   -maxnamelen Margin size for the sequence name. Any integer value 10
   -[no]number Display the residue number Boolean value Yes/No Yes
   -[no]listoptions Display the date and options used Boolean value
   Yes/No Yes
   -plurality Plurality check value (totweight/2) Any numeric value Half
   the total sequence weighting
   -consensus Display the consensus Boolean value Yes/No No
   -[no]collision Allow collisions in calculating consensus Boolean value
   Yes/No Yes
   -alternative Use alternative collisions routine 0) Normal collision
   check. (default) 1) checks identical scores with the max score found.
   So if any other residue matches the identical score then a collision
   has occurred. 2) If another residue has a greater than or equal to
   matching score and these do not match then a collision has occurred.
   3) Checks all those not in the current consensus.If any of these give
   a top score for matching or identical scores then a collision has
   occured. Integer from 0 to 3 0
   -showscore Print residue scores Any integer value -1
   -portrait Set page to Portrait Boolean value Yes/No No
   Advanced (Unprompted) qualifiers Allowed values Default
   (none)

Input file format

   prettyplot reads any sequence USA.

  Input files for usage example

  File: globins.msf

!!AA_MULTIPLE_ALIGNMENT 1.0

  ../data/globins.msf MSF:  164 Type: P 25/06/01 CompCheck: 4278 ..

  Name: HBB_HUMAN Len: 164  Check: 6914 Weight: 0.14
  Name: HBB_HORSE Len: 164  Check: 6007 Weight: 0.15
  Name: HBA_HUMAN Len: 164  Check: 3921 Weight: 0.15
  Name: HBA_HORSE Len: 164  Check: 4770 Weight: 0.19
  Name: MYG_PHYCA Len: 164  Check: 7930 Weight: 0.23
  Name: GLB5_PETMA Len: 164  Check: 1857 Weight: 0.21
  Name: LGB2_LUPLU Len: 164  Check: 2879 Weight: 0.10

//

           1                                               50
HBB_HUMAN  ~~~~~~~~VHLTPEEKSAVTALWGKVN.VDEVGGEALGR.LLVVYPWTQR
HBB_HORSE  ~~~~~~~~VQLSGEEKAAVLALWDKVN.EEEVGGEALGR.LLVVYPWTQR
HBA_HUMAN  ~~~~~~~~~~~~~~VLSPADKTNVKAA.WGKVGAHAGEYGAEALERMFLS
HBA_HORSE  ~~~~~~~~~~~~~~VLSAADKTNVKAA.WSKVGGHAGEYGAEALERMFLG
MYG_PHYCA  ~~~~~~~VLSEGEWQLVLHVWAKVEAD.VAGHGQDILIR.LFKSHPETLE
GLB5_PETMA PIVDTGSVAPLSAAEKTKIRSAWAPVYSTYETSGVDILVKFFTSTPAAQE
LGB2_LUPLU ~~~~~~~~GALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKD

           51                                             100
HBB_HUMAN  FFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSE
HBB_HORSE  FFDSFGDLSNPGAVMGNPKVKAHGKKVLHSFGEGVHHLDNLKGTFAALSE
HBA_HUMAN  FPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSD
HBA_HORSE  FPTTKTYFPHFDLSHGSAQVKAHGKKVGDALTLAVGHLDDLPGALSNLSD
MYG_PHYCA  KFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQ
GLB5_PETMA FFPKFKGLTTADQLKKSADVRWHAERIINAVNDAVASMDDTEKMSMKLRD
LGB2_LUPLU LFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLQVTGVVVTDATLKN

           101                                            150
HBB_HUMAN  LHCDKLH..VDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVA
HBB_HORSE  LHCDKLH..VDPENFRLLGNVLVVVLARHFGKDFTPELQASYQKVVAGVA
HBA_HUMAN  LHAHKLR..VDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVS
HBA_HORSE  LHAHKLR..VDPVNFKLLSHCLLSTLAVHLPNDFTPAVHASLDKFLSSVS
MYG_PHYCA  SHATKHK..IPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFR
GLB5_PETMA LSGKHAK..SFQVDPQYFKVLAAVIADTVAAGDAGFEKLMSMICILLRSA
LGB2_LUPLU LGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELA

           151        164
HBB_HUMAN  NALAHKYH~~~~~~
HBB_HORSE  NALAHKYH~~~~~~
HBA_HUMAN  TVLTSKYR~~~~~~
HBA_HORSE  TVLTSKYR~~~~~~
MYG_PHYCA  KDIAAKYKELGYQG
GLB5_PETMA Y~~~~~~~~~~~~~
LGB2_LUPLU IVIKKEMNDAA~~~

Output file format

   An image of the alignment is displayed on the specified graphics
   device.

  Output files for usage example

  Graphics File: prettyplot.ps

   [prettyplot results]

  Output files for usage example 2

  Graphics File: prettyplot.ps

   [prettyplot results]

Data files

   Prettyplot uses a comparison matrix file to calculate similarity to
   the consensus.

   For protein sequences EBLOSUM62 is used for the substitution matrix.
   For nucleotide sequence, EDNAFULL is used.

   EMBOSS data files are distributed with the application and stored in
   the standard EMBOSS data directory, which is defined by the EMBOSS
   environment variable EMBOSS_DATA.

   To see the available EMBOSS data files, run:

% embossdata -showall

   To fetch one of the data files (for example 'Exxx.dat') into your
   current directory for you to inspect or modify, run:

% embossdata -fetch -file Exxx.dat

   Users can provide their own data files in their own directories.
   Project specific files can be put in the current directory, or for
   tidier directory listings in a subdirectory called ".embossdata".
   Files for all EMBOSS runs can be put in the user's home directory, or
   again in a subdirectory called ".embossdata".

   The directories are searched in the following order:
     * . (your current directory)
     * .embossdata (under your current directory)
     * ~/ (your home directory)
     * ~/.embossdata

Notes

   None.

References

   None.

Warnings

   None.

Diagnostic Error Messages

   None.

Exit status

   It exits with status 0 unless an error is reported.

Known bugs

   Portrait mode does not cover the whole page! This is a "feature" in
   plplot.

See also

   Program name                        Description
   abiview      Reads ABI file and display the trace
   cirdna       Draws circular maps of DNA constructs
   emma         Multiple alignment program - interface to ClustalW program
   infoalign    Information on a multiple sequence alignment
   lindna       Draws linear maps of DNA constructs
   pepnet       Displays proteins as a helical net
   pepwheel     Shows protein sequences as helices
   plotcon      Plot quality of conservation of a sequence alignment
   prettyseq    Output sequence with translated ranges
   remap        Display sequence with restriction sites, translation etc
   seealso      Finds programs sharing group names
   showalign    Displays a multiple sequence alignment
   showdb       Displays information on the currently available databases
   showfeat     Show features of a sequence
   showseq      Display a sequence with features, translation etc
   sixpack      Display a DNA sequence with 6-frame translation and ORFs
   textsearch   Search sequence documentation. Slow, use SRS and Entrez!
   tranalign    Align nucleic coding regions given the aligned proteins

Author(s)

   Ian Longden (il  sanger.ac.uk)
   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge,
   CB10 1SA, UK.

   Many features were first implemented in the EGCG program "prettyplot"
   by Peter Rice (pmr  ebi.ac.uk)
   Informatics Division, European Bioinformatics Institute, Wellcome
   Trust Genome Campus, Hinxton, Cambridge CB10 1SD, UK

   The original suggestions for the PrettyPlot program were from Denis
   Duboule and Sigfried Labeit at EMBL. Gert Vriend added the star
   marking. Rita Grandori suggested the -NOCOLLISION option.

History

   Completed 5th May 1999.

Target users

   This program is intended to be used by everyone and everything, from
   naive users to embedded scripts.

Comments

   None
