
                                 ehmmemit 



Function

   Extract HMM sequences

Description

   **************** EDIT HERE ****************

Algorithm

   **************** EDIT HERE ****************

Usage

   Here is a sample session with ehmmemit


% ehmmemit rrm.hmm -seed 1079460101 
Extract HMM sequences
Output file [rrm.ehmmemit]: 

   Go to the input files for this example
   Go to the output files for this example

Command line arguments

   Standard (Mandatory) qualifiers:
  [-infile]            infile     HMM file
  [-outfile]           outfile    Output file name

   Additional (Optional) qualifiers: (none)
   Advanced (Unprompted) qualifiers:
   -seed               integer    Random seed
   -selex              boolean    Output in selex format
   -consensus          boolean    Output consensus sequence
   -number             integer    Number of sequences to produce

   Associated qualifiers:

   "-outfile" associated qualifiers
   -odirectory2        string     Output directory

   General qualifiers:
   -auto               boolean    Turn off prompts
   -stdout             boolean    Write standard output
   -filter             boolean    Read standard input, write standard output
   -options            boolean    Prompt for standard and additional values
   -debug              boolean    Write debug output to program.dbg
   -verbose            boolean    Report some/full command line options
   -help               boolean    Report command line options. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose
   -warning            boolean    Report warnings
   -error              boolean    Report errors
   -fatal              boolean    Report fatal errors
   -die                boolean    Report deaths


   Standard (Mandatory) qualifiers Allowed values Default
   [-infile]
   (Parameter 1) HMM file Input file Required
   [-outfile]
   (Parameter 2) Output file name Output file <sequence>.ehmmemit
   Additional (Optional) qualifiers Allowed values Default
   (none)
   Advanced (Unprompted) qualifiers Allowed values Default
   -seed Random seed Integer 0 or more 0
   -selex Output in selex format Boolean value Yes/No No
   -consensus Output consensus sequence Boolean value Yes/No No
   -number Number of sequences to produce Any integer value 10

Input file format

   ehmmemit reads any normal sequence USAs.

  Input files for usage example

  File: rrm.hmm

HMMER2.0
NAME  rrm
DESC
LENG  72
ALPH  Amino
RF    no
CS    no
MAP   yes
COM   ../src/hmmbuild -F rrm.hmm rrm.slx
COM   ../src/hmmcalibrate rrm.hmm
NSEQ  70
DATE  Wed Jul  8 08:13:25 1998
CKSUM 2768
XT      -8455     -4  -1000  -1000  -8455     -4  -8455     -4
NULT      -4  -8455
NULE     595  -1558     85    338   -294    453  -1158    197    249    902  -1
085   -142    -21   -313     45    531    201    384  -1998   -644
EVD   -53.840649   0.214434
HMM        A      C      D      E      F      G      H      I      K      L
  M      N      P      Q      R      S      T      V      W      Y
         m->m   m->i   m->d   i->m   i->i   d->m   d->d   b->m   m->e
          -21      *  -6129
     1  -1234   -371  -8214  -7849  -5304  -8003  -7706   2384  -7769   2261
-681  -7660  -7694  -7521  -7816  -7346  -5543   1527  -6974  -6639     1
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -11 -11284 -12326   -894  -1115   -701  -1378    -21      *
     2  -3634  -3460  -5973  -5340   3521  -2129  -4036   -831  -2054  -1257  -
2663  -4822  -5229  -4557  -4735  -1979  -1569  -1476  -3893   3439     2
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -11 -11284 -12326   -894  -1115   -701  -1378      *      *
     3  -5570    838  -8268  -7958  -5637  -8152  -8243   2427  -7947   -461
-539  -7805  -7843  -7878  -8124  -7550  -5559   3130  -7481  -7000     3
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -11 -11284 -12326   -894  -1115   -701  -1378      *      *
     4  -1146  -4797  -1564  -2630  -1480   2769  -2963  -1850    992  -4812  -
3887    737  -4397   -120    793   -205  -1019  -4418  -4981  -1059     4
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -11 -11284 -12326   -894  -1115   -701  -1378      *      *
     5  -5242  -7035    445  -3538  -7284   1773  -4583  -7166  -4676  -7046  -
6312   3633  -1651  -1262   -849  -1278  -5287  -6650  -7228   -291     5
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -11 -11284 -12326   -894  -1115   -701  -1378      *      *
     6  -6898  -6238  -9292  -8703   -410  -9176  -7772    820  -8535   3071
-753  -8917  -8033  -7171  -7955  -8614  -6722      5  -6136  -6414     6
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    278    394     45     96    359    117   -369   -294   -249
     -    -33  -6025 -12326   -153  -3315   -701  -1378      *      *
     7     -5  -5297    178  -2982  -5685  -2278   -528  -5452  -1615  -5394  -
4488   1396   3136  -3022  -3659    780    976  -4981  -5565  -4854     8
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -11 -11284 -12327   -894  -1115   -701  -1378      *      *
     8  -3329  -4799   -805    543    789  -4303    572  -4868    140  -1087  -
3888   -603   1691    530    183   -162    293  -2124   2317   2037     9
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -12 -11284 -12327   -894  -1115   -701  -1378      *      *
     9   -373  -4801   2182   1353  -1426     44   -407  -1928   -366  -4817  -
3891   1263  -4395  -1080   -666    295     50  -1947  -4985    397    10
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -12 -11285 -12327   -894  -1115   -701  -1378      *      *
    10    450   1883  -5953  -5317  -1256  -1301  -4027   1322  -1847   -283
1542  -4802  -5206  -1502  -4713  -4241   2143   1615  -3893  -3551    11
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -12 -11285 -12327   -894  -1115   -701  -1378      *      *


  [Part of this file has been deleted for brevity]

     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -17 -11290 -12332   -894  -1115   -701  -1378      *      *
    57  -2038  -3436  -5943  -5308  -1145  -5154  -4025   2255    423   1498
1203  -4797  -1707   -478  -1267  -2117  -3548   1450  -3893   -931    75
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -18 -11291 -12333   -894  -1115   -701  -1378      *      *
    58    622  -4802   1764   1486  -5123  -4302  -2961  -1060    334  -4818  -
3891   -420  -4396   1293   1148    487  -3268  -1087  -4985   -429    76
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -   -102 -11291  -4156   -894  -1115   -701  -1378      *      *
    59   1265   -231  -1498   1351  -5045   -262   -355  -4796    922  -1073  -
3813    778  -4318    877    -34     53    386  -2030    289  -4225    77
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -18 -11207 -12249   -894  -1115   -160  -3250      *      *
    60   -684    813  -5723   -473    532  -2124  -3981  -2958   -121   2114
2840  -1421  -5174  -4409   -926  -4196  -1685   -376  -3915    497    78
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -18 -11291 -12333   -894  -1115   -701  -1378      *      *
    61  -1812  -4803   1626   -749   -515  -1133   -415  -4875  -1294  -4819  -
3892   3181   -793   1470  -1377   -246  -3268  -4425  -4986   -193    79
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -18 -11291 -12333   -894  -1115   -701  -1378      *      *
    62  -1812  -4808  -1465     33  -1509   2998   1583  -4879    122  -4823  -
3897    972  -4400  -1078  -3055  -1613   -682  -4429  -4991  -1114    80
     -   -149   -500    232     43   -378    398    105   -627    212   -466
-721    275    393     45     98    359    117   -367   -295   -250
     -    -98  -4229 -12334    -49  -4901   -701  -1378      *      *
    63   -676  -4701   -742  -1422    825   -589   -545    255   1702  -2571
 812  -2986  -4424    796    418   -221   1302  -1179  -4912   1028    82
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -19 -11292 -12334   -894  -1115   -701  -1378      *      *
    64  -3341  -4695    350   1378  -1551  -1973  -2998    477   1265     78
 273  -1163     21    504  -1507  -1108    282    114    -19    473    83
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -19 -11292 -12334   -894  -1115   -701  -1378      *      *
    65  -3605  -3444   -949  -2090   2356  -1177  -4010   1410  -1703   1341
-404  -1673   -747  -4487  -4679  -2139  -1048   1197  -3900    411    84
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -19 -11292 -12334   -894  -1115   -701  -1378      *      *
    66   -655   -539   1179    279  -1324   1202  -2962  -1895    147   -682
1298   1427  -2056    608    756  -1119  -1893  -4419  -4982    140    85
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -19 -11292 -12335   -894  -1115   -701  -1378      *      *
    67  -1814  -4814    166  -2636  -5135   2921   -568  -4885  -1333  -2415  -
3903   1495  -4406   -312   -619    602  -1672  -4436  -4997  -4314    86
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -20 -11293 -12335   -894  -1115   -701  -1378      *      *
    68  -3329   1217   -624   -797  -1594  -4303   1580  -4872   2069  -2414  -
3890    617  -4396    283   2449   -560   -267  -2067  -4984  -1334    87
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -20 -11293 -12335   -894  -1115   -701  -1378      *      *
    69    108    566  -1460    747  -1608  -4306  -2965    -30   1407  -2607  -
3878    346   1033   -336    863  -1038    745    617  -4975  -4296    88
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -20 -11293 -12335   -894  -1115   -701  -1378      *      *
    70  -1318  -3465   -283   -172  -3423  -2053  -3974   1957  -4721   1761
1425  -4678  -1762  -4391  -1578  -1974  -1561   1341  -3918  -3570    89
     -   -149   -500    233     43   -381    399    106   -626    210   -466
-720    275    394     45     96    359    117   -369   -294   -249
     -    -20 -11293 -12336   -894  -1115   -701  -1378      *      *
    71  -1165  -4790   -240   -275  -5105  -4306   1035  -2009   1665   -395
 707  -1334   -218   -188   1891  -1077   -383    404    110    348    90
     -   -149   -500    233     43   -381    398    106   -626    210   -464
-720    275    394     45     96    359    117   -369   -294   -249
     -    -43  -6001 -12336   -150  -3342   -701  -1378      *      *
    72  -1929   1218  -1535  -1647  -3990  -4677  -3410   1725    207  -1481  -
3117  -3608   -810  -1118   -743  -1942    428   2687  -4325  -3869    92
     -      *      *      *      *      *      *      *      *      *      *
   *      *      *      *      *      *      *      *      *      *
     -      *      *      *      *      *      *      *      *      0
//

Output file format

   ehmmemit outputs a graph to the specified graphics device. outputs a
   report format file. The default format is ...

  Output files for usage example

  File: rrm.ehmmemit

>seq1
LFIKYLTTSCTETHLKDKFANYGEVVNIDIVLDADDGQLNGFGFIIFTSH
IEEQDAKKLDGKKYKGKVVES
>seq2
LFVGNLHPIGRPEQLKDLFVNAYQVTQIKLLTTTTARARGYGFIEFPSHL
SVTKAVAKKSGQGLSGNPVKI
>seq3
IYVNGLDDDVTEDELERLLREFGLFLAFQLCKQSGKFSGMAFIEYDNSDY
TQSIIRWLPGKVVMQRAITC
>seq4
VYITNLPPGVQKQELFDVKDTYFGEHGPVVRFNISRDDDDTQTGEASGFG
FITFEQLEDDNMAINEEAFGKLIGGKKAKV
>seq5
IFVGSVTHETTESLLKLTFSKQGGVKNINNPRDDETERSRNYATVEFTTE
EDAEAALENLRGIKINNRKLHI
>seq6
GYVERLPEYASQKSFKNVFQKRGSIKLSKLPTIAQNRGQGFVTFSKHEQA
AAALSEMNGDELEGKKISV
>seq7
LYVKNLPYGVDEDKIKDAFKSEGPITVKVVLIDAASLRIHGFGFIEFPSV
ADMAKAIKALEGFETFNVKIHI
>seq8
LFVGGLTYFAKEEALYDLLSKFAQSEQISLANDPETGMSKGYAYVRYETE
EDVDKAVENLDNIIFNGRTLRR
>seq9
IFVGNIDRKITRKEFENLFAPFGPSTVFPIIRGKNTGYAFVRYDDVQNAA
HLLESLDGTSDGAEVEKI
>seq10
MYIGNLASDITLDDLADIFSPNVRVVSAVLLKATGHSRGFAFVEFEKEEA
ATSCIANYENTEGNGHVVPV

Data files

   **************** EDIT HERE ****************

Notes

   None.

References

   None.

Warnings

   None.

Diagnostic Error Messages

   None.

Exit status

   It always exits with status 0.

Known bugs

   None.

See also

   Program name                Description
   ealistat      Statistics for multiple alignment files
   ehmmalign     Align sequences with an HMM
   ehmmbuild     Build HMM
   ehmmcalibrate Calibrate a hidden Markov model
   ehmmconvert   Convert between HMM formats
   ehmmfetch     Extract HMM from a database
   ehmmindex     Index an HMM database
   ehmmpfam      Align single sequence with an HMM
   ehmmsearch    Search sequence database with an HMM

Author(s)

   This program is an EMBOSS conversion of a program written by Sean Eddy
   as part of his HMMER package.

   Although we take every care to ensure that the results of the EMBOSS
   version are identical to those from the original package, we recommend
   that you check your inputs give the same results in both versions
   before publication.

   Please report all bugs in the EMBOSS version to the EMBOSS bug team,
   not to the original author.

History

Target users

   This program is intended to be used by everyone and everything, from
   naive users to embedded scripts.
